PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold06155-augustus-gene-0.11-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family TALE
Protein Properties Length: 366aa    MW: 41364.6 Da    PI: 6.6083
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold06155-augustus-gene-0.11-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092943282155
                                                    HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                                       Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                                    k +yps++++  LA+++gL+++q+ +WF N+R ++
  maker-scaffold06155-augustus-gene-0.11-mRNA-1 294 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 328
                                                    569*****************************885 PP

2ELK41.13.7e-14248269122
                                            ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                                                    ELK qLlrKYsgyLgsLkqEF+
  maker-scaffold06155-augustus-gene-0.11-mRNA-1 248 ELKGQLLRKYSGYLGSLKQEFM 269
                                                    9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.1E-15106155IPR005540KNOX1
PfamPF037902.0E-18108151IPR005540KNOX1
SMARTSM012564.1E-26161212IPR005541KNOX2
PfamPF037914.7E-21164210IPR005541KNOX2
SMARTSM011882.8E-8248269IPR005539ELK domain
PROSITE profilePS5121311.174248268IPR005539ELK domain
PfamPF037896.1E-11248269IPR005539ELK domain
PROSITE profilePS5007112.989268331IPR001356Homeobox domain
SMARTSM003897.4E-13270335IPR001356Homeobox domain
SuperFamilySSF466891.97E-19270345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28273333IPR009057Homeodomain-like
CDDcd000863.19E-12280332No hitNo description
PfamPF059206.6E-17288327IPR008422Homeobox KN domain
PROSITE patternPS000270306329IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MESGSNGTSC MMAFGENSSN GLCPMMMMMP LMTSHHSHHH PNADTNSLFL PLPPNNNHDH  60
QNQNRNTPTP TTNINNSSSF ILDDHNANSN TGLFFMESNN NEGSSSSVKA KIMAHPHYHR  120
LLAAYANCQK VLNKQVGAPP EVVARLEQAC STAANMGHSA STGCIGEDPA LDQFMEAYCE  180
MLTKYEQELS KPFKEAMLFL QRIECQFKAL AVSSSDSACV EAVDRNVSSE EEVDVNNNFI  240
DPQAEDRELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWS RHYKWPYPSE  300
SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DATHPHYYMD NVLGNPFPMD  360
ISPALL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263272LKQEFMKKRK
2269273KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518420.10.0PREDICTED: homeobox protein SBH1
SwissprotP466081e-164HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9RXF10.0B9RXF1_RICCO; Homeobox protein knotted-1, putative
STRINGVIT_10s0116g00190.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-140KNOX/ELK homeobox transcription factor